PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn213761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 581aa    MW: 65373.2 Da    PI: 9.7598
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn213761genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.26.1e-11338238
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                       WT++Ed++l  av+ +G  +W t+a+t+  gRt+k
       Achn213761  3 RDWTEDEDDKLRAAVEAFGESNWQTVASTLE-GRTDK 38
                     57*****************************.***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0056150IPR001005SANT/Myb domain
PROSITE profilePS5129415.124152IPR017930Myb domain
SuperFamilySSF466898.97E-8243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-11238IPR009057Homeodomain-like
PfamPF002495.3E-8338IPR001005SANT/Myb domain
CDDcd001671.14E-6538No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MKRDWTEDED DKLRAAVEAF GESNWQTVAS TLEGRTDKVP LLREAKKIKR TALRSNFVDQ  60
ESERPALGPN DFIPLALTNG ISESDNLNPS RKQKRKSRAS RSKENEKVSR ERPEAASRED  120
AILKKERAMK PYLKNKDTDP TKDHLPACAA SELLIMTTGE KEVRKFGKNR AAKIRKASKS  180
SQRTRKCVKL TDENSRMIKS DEVVSSGEND AISDENKTLS LPHLEQRKRC SVSTTSKITN  240
VNELEAISDD AVRKKNGRKL FSKSKYDRLM QELLERSDSS EVETLGNNDA SLKKRRINKR  300
SLKTCTASSN SFTRTENEVE PFSGNDATKQ RKSSKPSSSS KCIEPPKESK SLPLLPASLE  360
IRRADDEYIT TLHREKRAPR RKCFKQSRKH QDYTSSFLEV TKSQSKQSET TKLVEGFQNG  420
LLENDNSKAS GMCKQARLKR PRTREKTCSN HRSEEEEDDT TLALFVKNER KKRRLKLSRM  480
GNDAPCPGSM YRSESLYDEN FCNGGSNDGL SSQAVHSSHL EDPPCIAVGG IDCEKSHSVT  540
RGVSPFHESL KEAFYEGIDD PSDTFFPPPG FENPVYGVAS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1469476RKKRRLKL
2470475KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.34e-11myb domain protein 4r1